If you have been reading about BPC 157 and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-08-01. Where a claim depends on a specific study, the study is described rather than over-claimed.
Most published work on BPC-157 consists of preclinical studies, including rodent models of tissue injury, gastrointestinal lesions, and vascular or tendon damage, together with in vitro cell assays. Reviews frequently note that the mechanisms proposed in these papers remain incompletely characterised and that findings have not been confirmed in large randomised human trials. The compound is widely sold as a research chemical rather than a licensed medicine, and labels commonly carry a statement that it is not for human use. Whether any of the reported animal effects translate to humans is an open question rather than an established result.
Terminology in the literature is not fully standardised. Papers and product listings use BPC-157, BPC 157, and the longer phrase stable gastric pentadecapeptide BPC 157 interchangeably, and synonyms such as bepecin or PL 14736 appear in older or company-linked publications. Purity claims and reported masses can also differ between sources because peptide preparations may include counterions, residual solvents, or bound water. This variability complicates direct comparison of results across studies and makes the exact identity and grade of a given sample worth verifying. Discussions of the compound should therefore specify the source, salt form, and stated purity where those are known.
BPC-157 is a synthetic peptide composed of fifteen amino acid residues, with the sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val. Its name derives from body protection compound, a term used for a protein fraction identified in human gastric juice. Researchers in Zagreb first reported the pentadecapeptide in the early 1990s and described it as a stable fragment of that larger protein. The compound is also catalogued as PL 14736 and, in some commercial contexts, as bepecin. Its molecular formula is C62H98N16O22 and its monoisotopic mass is approximately 1419 daltons.
BPC-157 is a synthetic pentadecapeptide with the sequence GEPPPGKPADDAGLV, corresponding to a partial fragment of a larger protein detected in human gastric juice. The name derives from the parent protein designation BPC, an abbreviation of body protection compound, with 157 acting as a fraction or batch identifier used by the original investigators. Its molecular weight is approximately 1419 daltons, and the chain contains no unusual residues or disulfide bridges. In the literature it is described as a short, water-soluble fragment rather than a complete natural protein.
Most early work on this peptide originated in the 1990s from a research group in Zagreb, Croatia, relying on animal models and cell cultures. Reported observations included effects on gastrointestinal lesion healing, tendon fibroblast migration, and blood vessel formation under controlled laboratory conditions. These findings come predominantly from rodent studies and in vitro assays rather than from human trials. Controlled human data remain limited, and the degree to which animal results translate to human physiology is an open question rather than a settled fact.
| Property | Value | Notes |
|---|---|---|
| Molecular formula | C62H98N16O22 | Computed for the free peptide |
| Monoisotopic mass | Approximately 1419 Da | Reported values shift with counterion and hydration |
| Residue count | 15 amino acids | Sequence Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val |
| Origin | Fragment of human gastric juice protein | First described in early 1990s research reports |
| Common synonyms | BPC 157; PL 14736; bepecin | Naming varies across papers and catalogues |
Dry powder is generally stored at low temperature, with minus twenty degrees Celsius or colder advised for extended retention. Reconstituted solutions are less stable than the solid form and are normally kept cold and shielded from repeated freeze-thaw cycles. Light exposure is avoided because some peptides degrade under ultraviolet radiation. The exact rate of degradation depends on concentration, pH, and the presence of salts, so a single shelf life does not apply to every preparation. Reported stability figures should be read as indicative of typical handling rather than as universal constants.
Confirmation of identity and purity relies on standard peptide analysis techniques. Reverse-phase high-performance liquid chromatography separates the peptide from related impurities and serves as the most common purity assay. Mass spectrometry, often coupled to that chromatography step, provides an accurate molecular mass that can be matched against the expected value. Amino acid analysis or sequencing can be added for further confirmation. Because short peptides can be produced by different synthetic routes, laboratories usually report both a chromatographic purity percentage and a mass confirmation rather than a single figure.
BPC-157 is commonly supplied as a lyophilized powder, a freeze-dried solid that is reconstituted before use in laboratory work. As a short peptide, it dissolves readily in water and in aqueous buffer solutions, and stock solutions are typically prepared in water or a mild buffer. The chain contains several proline and acidic residues, which influence how it behaves in solution. Because the solid can take up moisture, weighing and handling are usually performed under low-humidity conditions. Its solubility class is described as freely soluble in water rather than requiring an organic solvent.
The sequence contains an unusually high proportion of proline and glycine, which limits regular secondary structure and contributes to solubility in aqueous media. The compound dissolves readily in water and in normal saline. Because it is a peptide, digestive enzymes are expected to break it down if it is swallowed, a consideration that influences the routes of administration used in animal experiments. Detailed conformational data remain limited, and published structural models are largely computational.
BPC 157 is a synthetic peptide built from fifteen amino acids. The letters stand for body protection compound, and the number is a laboratory code rather than a description of any biological feature. Its single-letter sequence is GEPPPGKPADDAGLV, which corresponds to a calculated mass near 1419.5 daltons. The material is produced by solid-phase peptide synthesis and is distributed as a lyophilized powder, not as a purified extract from a natural source.
Early work on this family of molecules examined fractions of human gastric juice, where a larger protein was reported to protect gastrointestinal tissue in animal models. BPC 157 was designed as a shorter, more stable fragment of that protein and then studied on its own. The peptide itself is not a normal dietary component and is not present in the human body in meaningful quantities. Descriptions of its origin therefore refer to the research lineage of a laboratory molecule rather than to an endogenous or nutritional substance.
Published storage guidance follows general peptide practice rather than product-specific studies. The dry powder is typically kept at minus 20 degrees Celsius, away from light and moisture. Once reconstituted, solutions are generally refrigerated and used over days to weeks, because the aqueous environment slowly promotes hydrolysis and oxidation. Long-term data on degradation rates or breakdown products are sparse. Stated shelf lives from different producers vary widely, reflecting the absence of a shared reference standard.
BPC-157 is a synthetic peptide built from fifteen amino acid residues. Its sequence comes from a larger protein fragment that researchers isolated from human gastric juice and described as a body protection compound. The fragment contains glycine, glutamic acid, five prolines, lysine, alanine, two aspartic acids, leucine, and valine. The number 157 in the name refers to the position of the stretch within the parent protein. Material used in laboratories is manufactured rather than extracted from stomach fluid.
The main chemical liabilities of this sequence are peptide-bond hydrolysis and possible aspartate-related reactions, since the peptide contains aspartic acid residues but no cysteine, methionine, or tryptophan. Absence of those three residues removes the most common oxidation and disulfide pathways from consideration. Studies of related peptides indicate that aspartate isomerisation and aspartimide formation occur most readily at Asp-Gly and Asp-Ala positions, and open questions remain about how quickly those reactions proceed under ordinary laboratory conditions. Storage guidance typically emphasises cool, dry, dark conditions to slow hydrolysis.
Identity and purity are usually assessed with reversed-phase high-performance liquid chromatography, often paired with mass spectrometry using electrospray or MALDI ionisation. Amino acid analysis and peptide mapping by enzymatic digestion provide additional sequence-level confirmation. Purity is commonly reported as an area percentage from a chromatographic trace, and water content can be measured by Karl Fischer titration. Reported masses may differ by tens of daltons between sources because preparations can contain acetate or trifluoroacetate counterions, and such differences are not by themselves evidence of a different peptide.
BPC-157 is normally distributed as a lyophilised powder that ranges from white to off-white in appearance. The peptide dissolves readily in water, normal saline, and common aqueous buffers, and it is poorly soluble in nonpolar solvents such as hexane or vegetable oils. Lyophilised vials take up moisture if left open, which changes the mass of powder in the container and complicates any later weighing. Because the material is handled in small quantities, static and adhesion to glass or plastic can also cause noticeable losses during transfer.
Internal Chinese government documents leaked to the press in November 2019 showed that Xi personally ordered a security crackdown in Xinjiang, saying that the party must show "absolutely no mercy" and that officials use all the "weapons of the people's democratic dictatorship" to suppress those "infected with the virus of extremism." The papers also showed that Xi repeatedly discussed Islamic extremism in his speeches, likening it to a "virus" or a "drug" that could be only addressed by "a period of painful, interventionary treatment." However, he also warned against the discrimination against Uyghurs and rejected proposals to eradicate Islam in China, calling that kind of viewpoint "biased, even wrong." Xi's exact role in the building of internment camps has not been publicly reported, though he's widely believed to be behind them and his words have been the source for major justifications in the crackdown in Xinjiang. China began to wind down the camps in 2019, and some detainees were transferred to the penal system, while others were transferred to forced labor and factory work programs. In a July 2022 visit to Xinjiang, Xi urged local officials to always listen to the citizens' voices and to improve efforts in preserving ethnic minority culture. In a visit to Xinjiang the following year, Xi stated that the region was "no longer a remote area" and should open up more for tourism to attract domestic and foreign visitors.
Unique identifiers for types of examined properties of the patient, supporting structured communication and storage of laboratory data in e.g. clinical laboratory reports or electronic health records Stable and unambiguous definitions of the types of examined properties, expressed using international nomenclatures, and in accordance with international standards Specification of measurement units where relevant A structure allowing for secure translation of the definitions into other languages
The Elaboration of the Central Dogma – Scitable: By Nature education Animation of Central Dogma from RIKEN - NatureDocumentaries.org Discussion on challenges to the "Central Dogma of Molecular Biology" Explanation of the central dogma using a musical analogy "Francis Harry Compton Crick (1916–2004)" by A. Andrei at the Embryo Project Encyclopedia
Sources: en.wikipedia.org
=== Vitamin D influence on immune response === Vitamin D is known as an immune regulator that assists in the adaptive and innate immune response. A deficiency in vitamin D, from hereditary or environmental influence, can lead to a more inefficient and weaker immune response and seen as a contributing factor to the development of autoimmune diseases. With vitamin D present, vitamin D response elements are encoded and expressed via pattern recognition receptors responses and the genes associated with those responses. The specific DNA target sequence expressed is known as 1,25-(OH)2D3. The expression of 1,25-(OH)2D3 can be induced by macrophages, dendritic cells, T-cells, and B-cells. In the presence of 1,25-(OH)2D3, the immune system's production of inflammatory cytokines are suppressed and more tolerogenic regulatory T-cells are expressed. This is due to vitamin D's influence on cell maturation, specifically T-cells, and their phenotype expression. Lack of 1,25-(OH)2D3 expression can lead to less tolerant regulatory T-cells, larger presentation of antigens to less tolerant T-cells, and increased inflammatory response.
== Personal life and death == French met Patricia Anne "Pat" Soule while attending Pasadena City College, and the two married in June 1950. They were married for 66 years, until her death in February 2017, and had two children. Pat worked as an acting teacher at Bellevue College and later worked with her husband on Imagination Theatre. French died in Seattle on December 20, 2017, at age 89.
== Mechanism of action == Alpha-glucosidase inhibitors are saccharides that act as competitive inhibitors of enzymes needed to digest carbohydrates: specifically alpha-glucosidase enzymes in the brush border of the small intestines. The membrane-bound intestinal alpha-glucosidases hydrolyze oligosaccharides, trisaccharides, and disaccharides to glucose and other monosaccharides in the small intestine. Acarbose also blocks pancreatic alpha-amylase in addition to inhibiting membrane-bound alpha-glucosidases. Pancreatic alpha-amylase hydrolyzes complex starches to oligosaccharides in the lumen of the small intestine. Inhibition of these enzyme systems reduces the rate of digestion of carbohydrates. Less glucose is absorbed because the carbohydrates are not broken down into glucose molecules. In diabetic patients, the short-term effect of these drugs therapies is to decrease current blood glucose levels: the long-term effect is a small reduction in hemoglobin A1c level.
The Houthi militias have captured dozens of tanks and masses of heavy weaponry from the Yemeni Armed Forces. In February 2017, the Houthis revealed their drone program. Between mid-2018 and 2019, long-range ballistic missile attacks decreased in frequency, while the Houthis increasingly began using unmanned aerial vehicles (UAVs) and artillery. UAVs were used for both attacks on military and civilian targets and reconnaissance. The Qasef UAV, which can carry up to 30 kilograms (66 lb) of explosives, had been used in over a dozen Houthi attacks since 2016. The Sammad-2, Sammad-3, and Qasif-2K suicide drones were unveiled in 2019. Houthi drone attacks peaked in 2021, with many targeting Saudi Arabia. In June 2019, the Saudi-led coalition stated that the Houthis had launched 226 ballistic missiles during the insurgency so far. The 2019 Abqaiq–Khurais attack targeted the Saudi Aramco oil processing facilities at Abqaiq and Khurais in eastern Saudi Arabia on 14 September 2019. The Houthi movement claimed responsibility, though the United States has asserted that Iran was behind the attack. Iranian President Hassan Rouhani said that "Yemeni people are exercising their legitimate right of defence ... the attacks were a reciprocal response to aggression against Yemen for years." The Houthis unveiled the Palestine-2 missile in June 2024, which closely resembled the Iranian Fattah-1 and Kheibar Shekan missiles. According to the Houthis, the missile was locally made, a claim rejected by defense analysts.
Sources: en.wikipedia.org
=== Enzyme activity === An enzyme's name is often derived from its substrate or the chemical reaction it catalyzes, with the word ending in -ase. Examples are lactase, alcohol dehydrogenase and DNA polymerase. Different enzymes that catalyze the same chemical reaction are called isozymes. The International Union of Biochemistry and Molecular Biology have developed a nomenclature for enzymes, the EC numbers (for "Enzyme Commission"). Each enzyme is described by "EC" followed by a sequence of four numbers which represent the hierarchy of enzymatic activity (from very general to very specific). That is, the first number broadly classifies the enzyme based on its mechanism while the other digits add more and more specificity. The top-level classification is:
== Side effects == Very common (incidence > 10%) adverse effects include constipation, dry mouth, and drowsiness at the beginning of treatment. Common (1% < incidence ≤ 10%) adverse effects include drowsiness during maintenance therapy, tremor, headache, dizziness, vertigo, and weakness. Uncommon (0.1% < incidence ≤ 1%) adverse effects include weight gain.
== Chemistry == Bulevirtide is a 47-amino acid long lipopeptide with the following sequence: CH3(CH2)12CO-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2 (C13H27CO-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2)
== Procedure == Add 1 ml of concentrated HNO3 to 1 ml of the test sample. Gently heat the mixture and cool it. Slowly add sodium hydroxide (NaOH, 40 % w/v in water) solution until the mixture becomes alkaline and a colour change is observed. If the colour changes from yellow to orange, this indicates the presence of an aromatic amino acid. When human skin or nails are exposed to nitric acid, they turn yellow after some time, indicating the presence of protein. The finger nails show a bright yellow colour (finger nails are made up of keratin, which is a protein) which cannot be scraped off, unlike the yellow colouration on the skin, which can be peeled off.
== Significance and legacy == In many accounts, the uprising marked the beginning of a sharp upswing in political mobilisation in South Africa and thus "profoundly altered power relations and heralded the beginning of the end of the apartheid regime". In particular, the uprising both revived older modes of non-violent protest – strikes, boycotts, and public demonstrations – and also moulded "a more militant political culture". Indeed, it occasioned a "dramatic increase in the scope of political violence in South Africa": according to the Ministry of Law and Order, the average yearly number of fatalities from political violence exceeded 1,850 per annum from 1985 to 1994, over 100 times the rate of fatalities in the prior nine-year period.
Sources: en.wikipedia.org
BPC-157 is a synthetic fifteen-amino-acid peptide whose sequence corresponds to a fragment of a protein found in human gastric juice. It is studied mainly in preclinical research and is not an approved pharmaceutical product in major markets. Materials sold for laboratory use are typically labelled as research chemicals.
No medicines regulator in the United States or the European Union has approved BPC-157 as a therapeutic product. Presenting it as a drug or as a dietary supplement ingredient would generally not match its regulatory status. Availability as a research chemical does not imply clinical approval.
Published reports rest largely on animal models and cell culture rather than controlled human trials. Review articles describe the proposed mechanisms as incompletely understood. Conclusions about effects in humans therefore remain tentative.
The sequence corresponds to a fragment of a protein found in human gastric juice, so related sequences are natural. The isolated fifteen-amino-acid peptide supplied for research is produced synthetically. Whether the free fragment circulates naturally in humans has not been settled.